Kin-Driver - A human kinase database with driver mutations




Multiple Sequence Alignment

Aminoacid Color Sheme:

Red: Aromatic and Hydrophobic (FYW)
Blue: Hydrophobic (AGILPV)
Green: Polar (DENQRHSTK)
Yellow: Sulphuretted (CM)

X Activating Mutation
XSelected mutation columns - G719A

Note: First 150 proteins are shown. Download the complete alignment in fasta format here

Central Moving

Average Plot

(mouse-over for more info)
   
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
   

Numbering (mouse-over)

   23456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678
EGFR_HUMAN/712-968   FKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEF
ACK1_HUMAN/126-385   -RLLEKLGDGSFGVVRRGEWD-APSGKTVSVAVKCLKPLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALR---
ALK_HUMAN/1116-1383   ITLIRGLGHGAFGEVYEGQVSGPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLSLPRFILLELMAGGDLKSFLRETPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILI--
CSF1R_HUMAN/582-910   -QFGKTLGAGAFGKVVEATAFGGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLQHENIVNLLGACTGGPVLVITEYCCYGDLLNFLRRKGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGIVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQIC---
EPHA2_HUMAN/613-871   VTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVISYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEAYTTSGGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIV---
EPHA5_HUMAN/675-932   -TIERVIGAGEFGEVCSGRLK-LPGKRELPVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIHLEGVVTSKPVMIVTEYMENGSLDTFLKKNDGQFTVIQLVGMLRGISAGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAYTTRGGKIPIRWTAPEAIAFRKFTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRLPSPMDCPAALYQLMLDCWQKERNSRPKFDEIV---
ERBB2_HUMAN/720-976   LRKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVF--
FGFR2_HUMAN/481-757   -TLGKPLGEGCFGQVVMAEAVGDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIKHKNIINLLGACTDGPLYVIVEYASKGNLREYLRAREEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLV---
FGFR3_HUMAN/472-748   -TLGKPLGEGCFGQVVMAEAIGDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIKHKNIINLLGACTGGPLYVLVEYAAKGNLREFLRAREEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLV---
FLT3_HUMAN/610-943   -EFGKVLGSGAFGKVMNATAYGSKTGVSIQVAVKMLKEKADSSEREALMSELKMMTQLSHENIVNLLGACTSGPIYLIFEYCCYGDLLNYLRSKLNVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDSNYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIVDANFYKLIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLT---
JAK1_HUMAN/583-845   LVQGEHLGRGTRTHIYSGTLMDTSEEKKIKVILKVLDPSHRDI-SLAFFEAASMMRQVSHKHIVYLYGVCVDVENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLARGPFIKLSDPGIPITV------LSRQECIERIPWIAPECVEDSKLSVAADKWSFGTTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPS--CKELADLMTRCMNYDPNQRPFFRAIMI--
JAK1_HUMAN/875-1149   LKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICT-GGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAITDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIGF-
JAK2_HUMAN/545-805   LIFNESLGQGTFTKIFKGVRREYGQLHETEVLLKVL-DKAHRNYSESFFEAASMMSKLSHKHLVLNYGVCVGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWAMHFLEENTLIHGNVCAKNILLIRPPFIKLSDPGISITV------LPKDILQERIPWVPPECIENPKLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPK--WAELANLINNCMDYEPDFRPSFRAII---
JAK2_HUMAN/849-1123   -KFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHST-EEHLRDFEREIEILKSLQHDNIVKYKGVCYRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRV
JAK3_HUMAN/521-777   -EWHENLGHGSFTKIYRGCRHEDGEARKTEVLLKVMDAKHKNC-MESFLEAASLMSQVSYRHLVLLHGVCMGDS-TMVQEFVHLGAIDMYLRKRGHLVPASWKLQVVKQLAYALNYLEDKGLPHGNVSARKVLLARPPFIKLSDPGVSPAV------LSLEMLTDRIPWVAPECLREAQLSLEADKWGFGATVWEVFSGVTMPISALDPAKKLQFYEDRQQLPAPK--WTELALLIQQCMAYEPVQRPSFRAVI---
JAK3_HUMAN/822-1095   LKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGP-DQQRDFQREIQILKALHSDFIVKYRGVSYRQSLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSERDVALCRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGQL-
KIT_HUMAN/589-924   -SFGKTLGAGAFGKVVEATAYGIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLNHMNIVNLLGACTGGPTLVITEYCCYGDLLNFLRRKELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVI--
MET_HUMAN/1078-1337   -HFNEVIGRGHFGCVYHGTLL-DNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVI--
PGFRA_HUMAN/593-950   -VLGRVLGSGAFGKVVEGTAYGSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLPHLNIVNLLGACTSGPIYIITEYCFYGDLVNYLHKNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMVDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSIV-
PGFRB_HUMAN/600-958   -VLGRTLGSGAFGQVVEATAHGSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLPHLNVVNLLGACTGGPIYIITEYCRYGDLVDYLHRNSPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGGTPYPELMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLL-
RET_HUMAN/724-1005   -VLGKTLGEGEFGKVVKATAFHKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSDGPLLLIVEYAKYGSLRGFLRESERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADIS---
TIE2_HUMAN/824-1092   -KFQDVIGEGNFGQVLKARIK--KDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLHHPNIINLLGACERGYLYLAIEYAPHGNLLDFLRKSASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSRGQ---EVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILL--
ABL1_HUMAN/242-493   -TMKHKLGGGQYGEVYEGVWK----KYSLTVAVKTLKEDTMEV--EEFLKEAAVMKEIKHPNLVQLLGVCTEPPFYIITEFMTYGNLLDYLRECRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLM-TGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHF--
ABL2_HUMAN/288-539   -TMKHKLGGGQYGEVYVGVWK----KYSLTVAVKTLKEDTMEV--EEFLKEAAVMKEIKHPNLVQLLGVCTEPPFYIVTEYMPYGNLLDYLRECREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLM-TGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHF--
ANPRA_HUMAN/543-801   Y------------------------YKGNLVAVKRVNRKRIEL-TRKVLFELKHMRDVQNEHLTRFVGACTPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGACSHGNLKSSNCVVDGRFVLKITDYGLESFR--DLDPEQGHTVYAKKLWTAPELLRMASGSQAGDVYSFGIILQEIALRGVFHVEGLSPKEIIERVTRGEQPPFRQSHLEELGLLMQRCWAEDPQERPPFQQIRTL-
ANPRB_HUMAN/518-786   N---------------------TGHFKGNVVAIKHVNKKRIEL-TRQVLFELKHMRDVQFNHLTRFIGACIPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISHGSLKSSNCVVDSRFVLKITDYGLASFR-STAEPDDSHALYAKKLWTAPELLSGNPGMQKADVYSFGIILQEIALRSGPFYLDLSPKEIVQKVRNGQRSIDRTQLNEELVLLMERCWAQDPAERPDFGQIKGFI
BLK_HUMAN/241-490   -RLVRKLGSGQFGEVWMGYYK-----NNMKVAIKTLKEGTMSP--EAFLGEANVMKALQHERLVRLYAVVTKEPIYIVTEYMARGCLLDFLKTDGSRLSLPRLIDMSAQIAEGMAYIERMNSIHRDLRAANILVSEALCCKIADFGLARII--DSEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWSFGVLLMEVVTYGRVPYPGMSNPEVIRNLERGYRMPRPDTCPPELYRVIAECWRSRPEERPTFEFLQL--
BMX_HUMAN/417-666   -TLLKELGSGQFGVVQLGKWK-----GQYDVAVKMIKEGSMSE--DEFFQEAQTMMKLSHPKLVKFYGVCSEYPIYIVTEYISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDRDLCVKVSDFGMTRYV-LDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSQVVLKVSQGHRLYRPHLASDTIYQIMYSCWHELPEKRPTFQQLLI--
BTK_HUMAN/402-651   -TFLKELGTGQFGVVKYGKWR-----GQYDVAIKMIKEGSMSE--DEFIEEAKVMMNLSHEKLVQLYGVCTQRPIFIITEYMANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYV-LDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADERPTFKILLI--
CSK_HUMAN/195-440   -KLLQTIGKGEFGDVMLGDYR------GNKVAVKCIKNDATAQ---AFLAEASVMTQLRHSNLVQLLGVIVKGGLYIVTEYMAKGSLVDYLRSRRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEA-----SSTQDTGKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLR---
DDR1_HUMAN/610-905   -RFKEKLGEGQFGEVHLCEVDSVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVDDPLCMITDYMENGDLNQFLSAHGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRQPFGQLTDEQVIENARDQGRLSRPPACPQGLYELMLRCWSRESEQRPPFSQLH---
DDR2_HUMAN/563-849   -TFKEKLGEGQFGEVHLCEVEGVSANQPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIHLLAVCIDDPLCMITEYMENGDLNQFLSRHVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGKNYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQQPYSQLSDEQVIENTRDQGRLPQPAICPDSVYKLMLSCWRRDTKNRPSFQEIHLL-
EPHA1_HUMAN/624-880   M-VDTVIGEGEFGEVYRGTLR-LPSQDCKTVAIKTLKDTSPGGQWWNFLREATIMGQFSHPHILHLEGVVTRKPIMIITEFMENGALDAFLREREDQLVPGQLVAMLQGIASGMNYLSNHNYVHRDLAARNILVNQNLCCKVSDFGLTRLLDDFDGTYETQGGKIPIRWTAPEAIAHRIFTTASDVWSFGIVMWEVLSFGDKPYGEMSNQEVMKSIEDGYRLPPPVDCPAPLYELMKNCWAYDRARRPHFQKLQ---
EPHA3_HUMAN/621-878   ISIDKVVGAGEFGEVCSGRLK-LPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAYTTRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIV---
EPHA4_HUMAN/621-878   -KIEKVIGVGEFGEVCSGRLK-VPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIV---
EPHA6_HUMAN/736-929   A----------------------------------------------------------------------GRPVMIVVEYMENGSLDSFLRKHDGHFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEAYTTTGGKIPIRWTAPEAIAYRKFSSASDAWSYGIVMWEVMSYGERPYWEMSNQDVILSIEEGYRLPAPMGCPASLHQLMLHCWQKERNHRPKFTDIV---
EPHA7_HUMAN/633-890   -KIERVIGAGEFGEVCSGRLK-LPGKRDVAVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTGKPVMIVIEFMENGALDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLSRVIEDDPEAYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVL--
EPHA8_HUMAN/635-892   -HIEKIIGSGDSGEVCYGRLR-VPGQRDVPVAIKALKAGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTGRLAMIVTEYMENGSLDTFLRTHDGQFTIMQLVGMLRGVGAGMRYLSDLGYVHRDLAARNVLVDSNLVCKVSDFGLSRVLEDDPDAYTTTGGKIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGERPYWNMTNRDVISSVEEGYRLPAPMGCPHALHQLMLDCWHKDRAQRPRFSQIV---
EPHAA_HUMAN/645-900   VTLERSLGGGRFGELCCGCLQ-LPGRQELLVAVHMLRDSASDSQRLGFLAEALTLGQFDHSHIVRLEGVVTGSTLMIVTEYMSHGALDGFLRRHEGQLVAGQLMGLLPGLASAMKYLSEMGYVHRGLAARHVLVSSDLVCKISGFGRGPRD-RSEAVYTTMSGRSPALWAAPETLQFGHFSSASDVWSFGIIMWEVMAFGERPYWDMSGQDVIKAVEDGFRLPPPRNCPNLLHRLMLDCWQKDPGERPRFSQIH---
EPHB1_HUMAN/619-878   VKIEEVIGAGEFGEVYKGRLK-LPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIV---
EPHB2_HUMAN/621-880   VKIEQVIGAGEFGEVCSGHLK-LPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIV---
EPHB3_HUMAN/633-892   VKIEEVIGAGEFGEVCRGRLK-QPGRREVFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTSRPVMILTEFMENCALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIV---
EPHB4_HUMAN/615-874   VKIEEVIGAGEFGEVCRGRLK-APGKKESCVAIKTLKGGYTERQRREFLSEASIMGQFEHPNIIRLEGVVTSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLSSDPTYTSSLGGKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPPDCPTSLHQLMLDCWQKDRNARPRFPQVV---
EPHB6_HUMAN/670-915   -KIEEVIGTGSFGEVRQGRLQ-PRGRREQTVAIQALWAGGAESLQMTFLGRAAVLGQFQHPNILRLEGVVTSRPLMVLTEFMELGPLDSFLRQREGQFSSLQLVAMQRGVAAAMQYLSSFAFVHRSLSAHSVLVNSHLVCKVARLGHSPQG-----------PSCLLRWAAPEVIAHGKHTTSSDVWSFGILMWEVMSYGERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKDRARRPHFDQLVAF-
ERBB3_HUMAN/709-965   LRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNVLLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELAF--
ERBB4_HUMAN/718-974   LKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAF--
FAK1_HUMAN/422-676   -ELGRCIGEGQFGDVHQGIYM-SPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYM-EDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELK---
FAK2_HUMAN/425-679   VVLNRILGEGFFGEVYEGVYT-NHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKNLDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYLESINCVHRDIAVRNILVASPECVKLGDFGLSRYI-EDEDYYKASVTRLPIKWMSPESINFRRFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTRCWDYDPSDRPRFTELVL--
FER_HUMAN/563-814   I-LGELLGKGNFGEVYKGTLK-----DKTSVAVKTCKEDLPQELKIKFLQEAKILKQYDHPNIVKLIGVCTRQPVYIIMELVSGGDFLTFLRRKKDELKLKQLVKFSLDAAAGMLYLESKNCIHRDLAARNCLVGENNVLKISDFGMSRQE-DGGVYSSSGLKQIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQAREQVERGYRMSAPQHCPEDISKIMMKCWDYKPENRPKFSELQ---
FES_HUMAN/561-814   -VLGEQIGRGNFGEVFSGRLR----ADNTLVAVKSCRETLPPDLKAKFLQEARILKQYSHPNIVRLIGVCTKQPIYIVMELVQGGDFLTFLRTEGARLRVKTLLQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKISDFGMSREEADGVYAASGGLRQVPVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGASPYPNLSNQQTREFVEKGGRLPCPELCPDAVFRLMEQCWAYEPGQRPSFSTIY---
FGFR1_HUMAN/478-754   -VLGKPLGEGCFGQVVLAEAIGDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIKHKNIINLLGACTDGPLYVIVEYASKGNLREYLQAREEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLV---
FGFR4_HUMAN/467-743   -VLGKPLGEGCFGQVVRAEAFGARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIRHKNIINLLGVCTEGPLYVIVECAAKGNLREFLRAREGPLSFPVLVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLV---
FGR_HUMAN/263-512   -TLERRLGTGCFGDVWLGTWN-----GSTKVAVKTLKPGTMSP--KAFLEEAQVMKLLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLDFLKNPGQDLRLPQLVDMAAQVAEGMAYMERMNYIHRDLRAANILVGERLACKIADFGLARLI-KDDEYNPCQGSKFPIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMNKREVLEQVEQGYHMPCPPGCPASLYEAMEQTWRLDPEERPTFEYLQ---
FRK_HUMAN/234-487   -QLLKRLGSGQFGEVWEGLWN-----NTTPVAVKTLKPGSMDP--NDFLREAQIMKNLRHPKLIQLYAVCTEDPIYIITELMRHGSLQEYLQNDGSKIHLTQQVDMAAQVASGMAYLESRNYIHRDLAARNVLVGEHNIYKVADFGLARVFDNEDIYESRHEIKLPVKWTAPEAIRSNKFSIKSDVWSFGILLYEIITYGKMPYSGMTGAQVIQMLAQNYRLPQPSNCPQQFYNIMLECWNAEPKERPTFETLRL--
FYN_HUMAN/271-520   -QLIKRLGNGQFGEVWMGTWN-----GNTKVAIKTLKPGTMSP--ESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLI-EDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQ---
GUC2C_HUMAN/499-745   C-----------------------KYDKKRVILKDLKHNDGNF-TEKQKIELNKLLQIDYYNLTKFYGTVKDTMIFGVIEYCERGSLREVLNDTGTFMDWEFKISVLYDIAKGMSYLHSSKEVHGRLKSTNCVVDSRMVVKITDFGCNSILPP-----------KKDLWTAPEHLRQANISQKGDVYSYGIIAQEIILRKETFIFRVENSNGMKPFRPDLFLETAEEKELEVYLLVKNCWEEDPEKRPDFKKIEL--
GUC2D_HUMAN/552-805   R--------------------------------------------PATKTAFSKLQELRHENVALYLGLFLEGPLAVVSEHCTRGSLQDLLAQREIKLDWMFKSSLLLDLIKGIRYLHHRGVAHGRLKSRNCIVDGRFVLKITDHGHGRLL-EAQKVLPEPPRAEDQLWTAPELLRDPAGTLAGDVFSLAIIMQEVVCRS-APYAMLTPEEVVQRVRSPPPLCRPDQAPVECILLMKQCWAEQPELRPSMDH--TFD
GUC2F_HUMAN/583-809   V--------------------------------------------------FEMMKDLRHENINPLLGFFYSGMFAIVTEFCSRGSLEDILTNQDVKLDWMFKSSLLLDLIKGMKYLHHREFVHGRLKSRNCVVDGRFVLKVTDYGFNDIL-EMLRLSEEESSMEELLWTAPELLRAPRGSFAGDVYSFAIIMQEVMVRG-TPFCMMPAQEIINRLKKPPPVVPPEHAPPECLQLMKQCWAEAAEQRPTFDEIFF--
HCK_HUMAN/262-511   -KLEKKLGAGQFGEVWMATYN-----KHTKVAVKTMKPGSMSV--EAFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVI-EDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPENCPEELYNIMMRCWKNRPEERPTFEYIQL--
IGF1R_HUMAN/999-1266   -TMSRELGQGSFGMVYEGVAKGVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSGQPTLVIMELMTRGDLKSYLRSLLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIII--
INSRR_HUMAN/979-1246   ISIIRELGQGSFGMVYEGLARGEAGEESTPVALKTVNELASPRECIEFLKEASVMKAFKCHHVVRLLGVVSGQPTLVIMELMTRGDLKSHLRSLLPQPALGEMIQMAGEIADGMAYLAANKFVHRDLAARNCMVSQDFTVKIGDFGMTRDVYETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQVLKFVMDGGVLEELEGCPLQLQELMSRCWQPNPRLRPSFTHILSI-
INSR_HUMAN/1023-1290   -TLLRELGQGSFGMVYEGNARDIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSGQPTLVVMELMAHGDLKSYLRSLRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIV---
ITK_HUMAN/363-612   -TFVQEIGSGQFGLVHLGYWL-----NKDKVAIKTIREGAMSE--EDFIEEAEVMMKLSHPKLVQLYGVCLQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGMTRFV-LDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLL---
KSR1_HUMAN/611-875   VELGEPIGQGRWGRVHRGRWH-------GEVAIRLLEMGHNQDHLKLFKKEVMNYRQTRHENVVLFMGACMPPHLAIITSFCKGRTLHSFVRDPKTSLDINKTRQIAQEIIKGMGYLHAKGIVHKDLKSKNVFYD-NGKVVITDFGLFGISGVVREGRRENQLKLSHDWLAPEIVREMTFSKAADVYAFGTVWYELQA-RDWPLKNQAAEASIWQIGSGEGMKRSVSLGKEVSEILSACWAFDLQERPSFSLLM---
KSR2_HUMAN/666-928   -EIGELIGKGRFGQVYHGRWH-------GEVAIRLIIERDNEDQLKAFKREVMAYRQTRHENVVLFMGACMPPHLAIITSLCKGRTLYSVVRDAKIVLDVNKTRQIAQEIVKGMGYLHAKGILHKDLKSKNVFYD-NGKVVITDFGLFSISGVLQAGRREDKLRIQNGWLAPEIIRQLSFSKHSDVFALGTIWYELHA-REWPFKTQPAEAIIWQMGTGMKPNSQIGMGKEISDILLFCWAFEQEERPTFTKLM---
KSYK_HUMAN/371-626   E--DKELGSGNFGTVKKGYYQ--MKKVVKTVAVKILKNEANDPAKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQN-RHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRL
LCK_HUMAN/245-494   -KLVERLGAGQFGEVWMGYYN-----GHTKVAVKSLKQGSMSP--DAFLAEANLMKQLQHQRLVRLYAVVTQEPIYIITEYMENGSLVDFLKTPGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLI-EDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRL--
LTK_HUMAN/510-777   VTLLRALGHGAFGEVYEGLVIGPGDSSPLQVAIKTLPELCSPQDELDFLMEALIISKFRHQNIVRCVGLSLATPRLILLELMSGGDMKSFLRHSPSPLVMRDLLQLAQDIAQGCHYLEENHFIHRDIAARNCLLSCSRVAKIGDFGMARDIYRASYYRRGDRALLPVKWMPPEAFLEGIFTSKTDSWSFGVLLWEIFSLGYMPYPGRTNQEVLDFVVGGGRMDPPRGCPGPVYRIMTQCWQHEPELRPSFASIL---
LYN_HUMAN/247-497   -KLVKRLGAGQFGEVWMGYYN-----NSTKVAVKTLKPGTMSV--QAFLEEANLMKTLQHDKLVRLYAVVTEEPIYIITEYMAKGSLLDFLKSDGGKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVI-EDNEYTAREGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCWKEKAEERPTFDYLQL--
MATK_HUMAN/235-478   -TLGAQIGEGEFGAVLQGEYL------GQKVAVKNIKCDVTAQ---AFLDETAVMTKMQHENLVRLLGVILHQGLYIVMEHVSKGNLVNFLRTRRALVNTAQLLQFSLHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAE-----RKGLDSSRLPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLA---
MERTK_HUMAN/587-854   LILGKILGEGEFGSVMEGNLK-QEDGTSLKVAVKTMKDNSSQREIEEFLSEAACMKDFSHPNVIRLLGVCIMSSPMVILPFMKYGDLHTYLLYSPKHIPLQTLLKFMVDIALGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTDPLDRPTFSVLRQL-
MLKL_HUMAN/209-466   Y---------------K------GEYHRAPVAIKVFKKQAGSIARQTFNKEIKTMKKFESPNILRIFGICIETVFSIVMEYCELGTLRELLDRE-KDLTLGKRMVLVLGAARGLYRLHHSEELHGKIRSSNFLVTQGYQVKLAGFELRKTQTSMSTTREKTDRVKSTAYLSPQELEDVFYDVKSEIYSFGIVLWEIAT-GDIPFQGCNSEKIRKLVVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEIL---
MUSK_HUMAN/575-856   IEYVRDIGEGAFGRVFQARAPGLPYEPFTMVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAGKPMCLLFEYMAYGDLNEFLRSMPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATRNCLVGENMVVKIADFGLSRNIYSADYYKANENDAIPIRWMPPESIFYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILSCPENCPVELYNLMRLCWSKLPADRPSFTSIH---
NTRK1_HUMAN/510-781   V-LKWELGEGAFGKVFLAECHNLPEQDKMLVAVKALKEASESA-RQDFQREAELLTMLQHQHIVRFFGVCTGRPLLMVFEYMRHGDLNRFLRSHPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVH---
NTRK2_HUMAN/538-807   IVLKRELGEGAFGKVFLAECYNCPEQDKILVAVKTLKDASDNA-RKDFHREAELLTNLQHEHIVKFYGVCVGDPLIMVFEYMKHGDLNKFLRAHPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHL--
NTRK3_HUMAN/538-824   IVLKRELGEGAFGKVFLAECYNSPTKDKMLVAVKALKDPTLAA-RKDFQREAELLTNLQHEHIVKFYGVCGGDPLIMVFEYMKHGDLNKFLRAHKGELGLSQMLHIASQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYEVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVIECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIY---
PTK6_HUMAN/191-441   FTLCRKLGSGYFGEVFEGLWK-----DRVQVAIKVISRDNLLH-QQMLQSEIQAMKKLRHKHILALYAVVSGDPVYIITELMAKGSLLELLRDSEKVLPVSELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGDFGLARLI-KEDVY-LSHDHNIPYKWTAPEALSRGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALR---
PTK7_HUMAN/796-1061   P--ITTLGKSEFGEVFLAKAQGEEGVAETLVLVKSLQSK-DEQQQLDFRRELEMFGKLNHANVVRLLGLCRAEPHYMVLEYVDLGDLKQFLRISSQPLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHF-RQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLAGKARLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIA---
RON_HUMAN/1082-1341   S--DRVIGKGHFGVVYHGEYI-DQAQNRIQCAIKSLSRITEMQQVEAFLREGLLMRGLNHPNVLALIGIMLEGLPHVLLPYMCHGDLLQFIRSPQRNPTVKDLISFGLQVARSMEYLAEQKFVHRDLAARNCMLDESFTVKVADFGLARDILDREYYQQHRHARLPVKWMALESLQTYRFTTKSDVWSFGVLLWELLTRGAPPYRHIDPFDLTHFLAQGRRLPQPEYCPDSLYQVMQQCWEADPAVRPTFRVLVEV-
ROR1_HUMAN/473-746   VRFMEELGECAFGKIYKGHLYLPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLGAVTEQPVCMLFEYINQGDLHEFLIMRKSSLDHGDFLHIAIQIAAGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSLLPIRWMPPEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPRMYSLMTECWNEIPSRRPRFKDIHL--
ROR2_HUMAN/473-746   VRFMEELGEDRFGKVYKGHLFGAPGEQTQAVAIKTLKDKAEGPLREEFRHEAMLRARLQHPNVVCLLGVVTDQPLSMIFSYCSHGDLHEFLVMRKSALEPPDFVHLVAQIAAGMEYLSSHHVVHKDLATRNVLVYDKLNVKISDLGLFREVYAADYYKLLGNSLLPIRWMAPEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDDCPAWVYALMIECWNEFPSRRPRFKDIH---
ROS1_HUMAN/1945-2215   T-LRLLLGSGAFGEVYEGTAVDGVGSGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLNEPQYIILELMEGGDLLTYLRKAGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVPRIVKIGDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQPYPAHSNLDVLNYVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQ---
RYK_HUMAN/327-593   ITLKDVLQEGTFGRIFHGILIDKDPNKEKQAFVKTVKDQASEIQVTMMLTESCKLRGLHHRNLLPITHVCIGEKPMVILPYMNWGNLKLFLRQCPQAISQQDLVHMAIQIACGMSYLARREVIHKDLAARNCVIDDTLQVKITDNALSRDLFPMDYHCLGDNENRPVRWMALESLVNNEFSSASDVWAFGVTLWELMTLGQTPYVDIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKFQQLV---
SG196_HUMAN/81-225   R-QLKRVGEGAVKRVFLSEWK------EHKVALSQLTSLE---MKDDFLHGLQMLKSLQGTHVVTLLGYCEDN--TMLTEYHPLGSLSNL-EETLNLSKYQNVNTWQHRLELAMDYVSIINYLHHS--------------------------------------------------------------------------------------------------------------------------------PVG
SRC_HUMAN/270-519   LRLEVKLGQGCFGEVWMGTWN-----GTTRVAIKTLKPGTMSP--EAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGEGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLI-EDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQ---
SRMS_HUMAN/230-480   A-LGRKLGEGYFGEVWEGLWL-----GSLPVAIKVIKSANMK--LTDLAKEIQTLKGLRHERLIRLHAVCSGEPVYIVTELMRKGNLQAFLGTPGRALRLPPLLGFACQVAEGMSYLEEQRVVHRDLAARNVLVDDGLACKVADFGLARLL-KDDIYSPSSSSKIPVKWTAPEAANYRVFSQKSDVWSFGVLLHEVFTYGQCPYEGMTNHETLQQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLR---
STYK1_HUMAN/114-380   E-VLEQICSGSCGPIFRANMNTGDPSKPKSVILKALKEPAGLHEVQDFLGRIQFHQYLKHKNLVQLEGCCTKLPLYMVLEDVAQGDLLSFLWTCLYDLTEKQVYHIGKQVLLALEFLQEKHLFHGDVAARNILMQSDLTAKLCGLGLAYEVYTRGAI--SSTQTIPLKWLAPERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKIMKRPSSCTHTMYSIMKSCWRWREADRPSPRELRLRL
TEC_HUMAN/370-619   -TFMRELGSGLFGVVRLGKWR-----AQYKVAIKAIREGAMCE--EDFIEEAKVMMKLTHPKLVQLYGVCTQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMEYLERNSFIHRDLAARNCLVSEAGVVKVSDFGMARYV-LDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEVFTEGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYEVMLRCWQEKPEGRPSFEDLLI--
TESK2_HUMAN/59-309   C---EKIGSGFFSEVFKVRHR----ASGQVMALKMN---TLSSNRANMLKEVQLMNRLSHPNILRFMGVCVQGQLHALTEYINSGNLEQLLDSN-LHLPWTVRVKLAYDIAVGLSYLHFKGIFHRDLTSKNCLIKRGYSAVVADFGLAEKIPDVSMGSEKLAVVGSPFWMAPEVLRDEPYNEKADVFSYGIILCEIIARIQADPDYLPRTENFGLDYD-AFQHMVGDCPPDFLQLTFNCCNMDPKLRPSFVEIGL--
TEX14_HUMAN/263-509   L-------------------------------------------ADLLIAEQEHSSKLRHPYLLQLMAVCLLEKTRLVYERITIGTLFSVLHERFPVLHMEVIVHLLLQISDALRYLHFQGFIHRSLSSYAVHIISPGEARLTNLEYMLES--EDRGVQRDLTRVPLNWAAPEVILQKAATVKSDIYSFSMIMQEILT-DDIPWKGLDGSVVKKAVVSGNYLEADVRLPKPYYDIVKSGIHVKQKDRT------MNL
TIE1_HUMAN/839-1107   ITFEDLIGEGNFGQVIRAMIK--KDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLHHPNIINLLGACKRGYLYIAIEYAPYGNLLDFLRKSASTLSSRQLLRFASDAANGMQYLSEKQFIHRDLAARNVLVGENLASKIADFGLSRGE---EVYVKKTMGRLPVRWMAIESLNYSVYTTKSDVWSFGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCDDEVYELMRQCWRDRPYERPPFAQIAL--
TNK1_HUMAN/116-377   R--GELLGSGCFGVVHRGLWT-LPSGKSVPVAVKSLPEGPMGTELGDFLREVSVMMNLEHPHVLRLHGLVLGQPLQMVMELAPLGSLHARLTAPTPPLLVALLCLFLRQLAGAMAYLGARGLVHRDLATRNLLLASPRTIKVADFGLVRPLGARGRYVMGGPRPIPYAWCAPESLRHGAFSSASDVWMFGVTLWEMFSGGEEPWAGVPPYLILQRLEDRARLPRPPLCSRALYSLALRCWAPHPADRPSFSHLEGLL
TXK_HUMAN/271-520   LAFIKEIGSGQFGVVHLGEWR-----SHIQVAIKAINEGSMSE--EDFIEEAKVMMKLSHSKLVQLYGVCIRKPLYIVTEFMENGCLLNYLRENKGKLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTRYV-LDDEYVSSFGAKFPIKWSPPEVF